TXNDC2 polyclonal antibody
  • TXNDC2 polyclonal antibody

TXNDC2 polyclonal antibody

Ref: AB-PAB21046
TXNDC2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TXNDC2.
Información adicional
Size 100 uL
Gene Name TXNDC2
Gene Alias DKFZp434H0311|MGC35026|SPTRX|SPTRX1
Gene Description thioredoxin domain-containing 2 (spermatozoa)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq KELGMESVKAGASGKPEMRLGTQEETSEGDANESSLLVLSSNVPLLALEFLEIAQAKEKAFLPMVSHTFHMRTEESDASQEGDDLPKSSANTSHPKQDDSPKSSEETIQP
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TXNDC2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84203
Iso type IgG

Enviar uma mensagem


TXNDC2 polyclonal antibody

TXNDC2 polyclonal antibody