BNC2 polyclonal antibody
  • BNC2 polyclonal antibody

BNC2 polyclonal antibody

Ref: AB-PAB21043
BNC2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant BNC2.
Información adicional
Size 100 uL
Gene Name BNC2
Gene Alias BSN2|DKFZp686A01127|FLJ20043|FLJ34928
Gene Description basonuclin 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq YENESESSEPKLGEESMEGDEHIHSEVSEKVLMNSERPDENHSEPSHQDVIKVKEEFTDPTYDMFYMSQYGLYNGGGASMAALHESFTSSLNYGSPQKFSPEGDLCSSPDPKICYVCKKSFKSSYSVK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human BNC2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54796
Iso type IgG

Enviar uma mensagem


BNC2 polyclonal antibody

BNC2 polyclonal antibody