BTG3 polyclonal antibody
  • BTG3 polyclonal antibody

BTG3 polyclonal antibody

Ref: AB-PAB21035
BTG3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant BTG3.
Información adicional
Size 100 uL
Gene Name BTG3
Gene Alias ANA|MGC8928|TOB5|TOB55|TOFA
Gene Description BTG family, member 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq VDPCEVCCRYGEKNNAFIVASFENKDENKDEISRKVTRALDKVTSDYHSGSSSSDEETSKEMEVKPSSVT
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human BTG3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10950
Iso type IgG

Enviar uma mensagem


BTG3 polyclonal antibody

BTG3 polyclonal antibody