URB1 polyclonal antibody
  • URB1 polyclonal antibody

URB1 polyclonal antibody

Ref: AB-PAB21034
URB1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant URB1.
Información adicional
Size 100 uL
Gene Name URB1
Gene Alias C21orf108|KIAA0539|NPA1
Gene Description URB1 ribosome biogenesis 1 homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq VEHHKTCRSLGRSLWQQPSVGDILRLLDRDRMMQTILHFPQNRRLLPPEDTQELIFKDKSRVDLDGLYDPCFLLQLFSELTRPEFVVDCRKFLDSNALGLTVTALSSYDP
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human URB1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9875
Iso type IgG

Enviar uma mensagem


URB1 polyclonal antibody

URB1 polyclonal antibody