CBLB polyclonal antibody
  • CBLB polyclonal antibody

CBLB polyclonal antibody

Ref: AB-PAB21033
CBLB polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CBLB.
Información adicional
Size 100 uL
Gene Name CBLB
Gene Alias DKFZp686J10223|DKFZp779A0729|DKFZp779F1443|FLJ36865|FLJ41152|Nbla00127|RNF56
Gene Description Cas-Br-M (murine) ecotropic retroviral transforming sequence b
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PPGSSSRPSSGQDLFLLPSDPFVDLASGQVPLPPARRLPGENVKTNRTSQDYDQLPSCSDGSQAPARPPKPRPRRTAPEIHHRKP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CBLB.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 868
Iso type IgG

Enviar uma mensagem


CBLB polyclonal antibody

CBLB polyclonal antibody