RWDD2B polyclonal antibody
  • RWDD2B polyclonal antibody

RWDD2B polyclonal antibody

Ref: AB-PAB21032
RWDD2B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RWDD2B.
Información adicional
Size 100 uL
Gene Name RWDD2B
Gene Alias C21orf6|GL011
Gene Description RWD domain containing 2B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq LIRHREDIPFDGTNDETERQRKFSIFEEKVFSVNGARGNHMDFGQLYQFLNTKGCGDVFQMFFGVEGQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RWDD2B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10069
Iso type IgG

Enviar uma mensagem


RWDD2B polyclonal antibody

RWDD2B polyclonal antibody