SPATA3 polyclonal antibody
  • SPATA3 polyclonal antibody

SPATA3 polyclonal antibody

Ref: AB-PAB21026
SPATA3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SPATA3.
Información adicional
Size 100 uL
Gene Name SPATA3
Gene Alias TSARG1
Gene Description spermatogenesis associated 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MKKVKKKRSEARRHRDSTSQHASSNSTSQQPSPESTPQQPSPESTPQHSSLETTSRQPAFQALPAPEIRRSSCCLLSPDAN
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SPATA3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 130560
Iso type IgG

Enviar uma mensagem


SPATA3 polyclonal antibody

SPATA3 polyclonal antibody