TMEM186 polyclonal antibody
  • TMEM186 polyclonal antibody

TMEM186 polyclonal antibody

Ref: AB-PAB21025
TMEM186 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMEM186.
Información adicional
Size 100 uL
Gene Name TMEM186
Gene Alias C16orf51|DKFZp564K2062
Gene Description transmembrane protein 186
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq GKAVWERPLHGLWCCSGQEDPKRWVGSSSPISKEKLPNAETEKFWMFYRFDAI
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMEM186.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 25880
Iso type IgG

Enviar uma mensagem


TMEM186 polyclonal antibody

TMEM186 polyclonal antibody