C16orf80 polyclonal antibody
  • C16orf80 polyclonal antibody

C16orf80 polyclonal antibody

Ref: AB-PAB21020
C16orf80 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C16orf80.
Información adicional
Size 100 uL
Gene Name C16orf80
Gene Alias EVORF|GTL3|fSAP23
Gene Description chromosome 16 open reading frame 80
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GFLSILYSIGSKPLQIWDKKVRNGHIKRITDNDIQSLVLEIEGTNVSTTYITCPADPKKTLGIKLPFLVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDDGWNQIQFNLL
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C16orf80.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 29105
Iso type IgG

Enviar uma mensagem


C16orf80 polyclonal antibody

C16orf80 polyclonal antibody