PCNXL3 polyclonal antibody
  • PCNXL3 polyclonal antibody

PCNXL3 polyclonal antibody

Ref: AB-PAB21009
PCNXL3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PCNXL3.
Información adicional
Size 100 uL
Gene Name PCNXL3
Gene Alias FLJ22427
Gene Description pecanex-like 3 (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LIGDLPQTPPGAVPDPSLASTDSSEPSPLAGDGAPWSGSSMADTPMSPLLKGSLSQELSKSFLTLTRPDRALVRTSSRREQRRGAGGYQPLDRRGSGEPTPQKAGSSDSCFS
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PCNXL3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 399909
Iso type IgG

Enviar uma mensagem


PCNXL3 polyclonal antibody

PCNXL3 polyclonal antibody