LPPR5 polyclonal antibody
  • LPPR5 polyclonal antibody

LPPR5 polyclonal antibody

Ref: AB-PAB21007
LPPR5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LPPR5.
Información adicional
Size 100 uL
Gene Name LPPR5
Gene Alias PAP2|PAP2D|PRG5
Gene Description lipid phosphate phosphatase-related protein type 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EHIHMDNLAQMPMISIPRVESPLEKVTSVQNHITAFAEVT
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LPPR5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 163404
Iso type IgG

Enviar uma mensagem


LPPR5 polyclonal antibody

LPPR5 polyclonal antibody