SVOPL polyclonal antibody
  • SVOPL polyclonal antibody

SVOPL polyclonal antibody

Ref: AB-PAB21004
SVOPL polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SVOPL.
Información adicional
Size 100 uL
Gene Name SVOPL
Gene Alias MGC46715
Gene Description SVOP-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PESARFNVSTGNTRAALATLERVAKMNRSVMPEGKLVEPVLEKRGRFADLLDAKYLRTTL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SVOPL.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 136306
Iso type IgG

Enviar uma mensagem


SVOPL polyclonal antibody

SVOPL polyclonal antibody