TMEM180 polyclonal antibody
  • TMEM180 polyclonal antibody

TMEM180 polyclonal antibody

Ref: AB-PAB21001
TMEM180 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMEM180.
Información adicional
Size 100 uL
Gene Name TMEM180
Gene Alias C10orf77|FLJ22529|bA18I14.8
Gene Description transmembrane protein 180
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq QLLRRRVEAARKDPGCSGLVVDSGLCGEELLVGSEEADSITLGRYLRQLARHRN
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMEM180.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79847
Iso type IgG

Enviar uma mensagem


TMEM180 polyclonal antibody

TMEM180 polyclonal antibody