LYSMD3 polyclonal antibody
  • LYSMD3 polyclonal antibody

LYSMD3 polyclonal antibody

Ref: AB-PAB20998
LYSMD3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LYSMD3.
Información adicional
Size 100 uL
Gene Name LYSMD3
Gene Alias DKFZp686F0735|FLJ13542
Gene Description LysM, putative peptidoglycan-binding, domain containing 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq FSSLTETLCPPKGRQTSRHSSVQYSSEQQEILPANDSLAYSDSAGSFLKEVDRDIEQIVKCTDNKRENLNEVVSALTAQQMRFEPDNKNTQRKDPYYGADW
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LYSMD3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 116068
Iso type IgG

Enviar uma mensagem


LYSMD3 polyclonal antibody

LYSMD3 polyclonal antibody