TTC13 polyclonal antibody
  • TTC13 polyclonal antibody

TTC13 polyclonal antibody

Ref: AB-PAB20997
TTC13 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TTC13.
Información adicional
Size 100 uL
Gene Name TTC13
Gene Alias FLJ22584
Gene Description tetratricopeptide repeat domain 13
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EERTQLYHAEIDALYKDLTAKGKVLILSSEFGEADAVCNLILSLVYYFYNLMPLSRGSSVIAYSVIVGALMASGKEVAGKIPKGKLVDFEAMTAPGSEAFSKVAKSWMNLKSISPSYKTLPSVSETFPTLRSMIEVLNTDSSPRCL
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TTC13.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79573
Iso type IgG

Enviar uma mensagem


TTC13 polyclonal antibody

TTC13 polyclonal antibody