LRRC3 polyclonal antibody
  • LRRC3 polyclonal antibody

LRRC3 polyclonal antibody

Ref: AB-PAB20986
LRRC3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LRRC3.
Información adicional
Size 100 uL
Gene Name LRRC3
Gene Alias C21orf102
Gene Description leucine rich repeat containing 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GAVAVFCSLRGLQEVPEDIPANTVLLKLDANKISHLPDGAFQHLHRLRELDLSHNAIEAIGSATFAGLAGGLRLLDLSYNRIQRIPKDALGKLSAKIRLSHNPLHCECALQEALWELKLDPDSVDEIACHTSVQEEFVGKP
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LRRC3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 81543
Iso type IgG

Enviar uma mensagem


LRRC3 polyclonal antibody

LRRC3 polyclonal antibody