PALMD polyclonal antibody
  • PALMD polyclonal antibody

PALMD polyclonal antibody

Ref: AB-PAB20984
PALMD polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PALMD.
Información adicional
Size 100 uL
Gene Name PALMD
Gene Alias C1orf11|FLJ20271|PALML
Gene Description palmdelphin
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq YDDGQKSVYAVSSNHSAAYNGTDGLAPVEVEELLRQASERNSKSPTEYHEPVYANPFYRPTTPQRETVTPGPNFQERIKIKTNGLGIGVNESIHNMGNGLSEERGNNFNHISPIPPVPHPRSVIQQAEEKLHTP
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PALMD.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54873
Iso type IgG

Enviar uma mensagem


PALMD polyclonal antibody

PALMD polyclonal antibody