LRRC8B polyclonal antibody
  • LRRC8B polyclonal antibody

LRRC8B polyclonal antibody

Ref: AB-PAB20982
LRRC8B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LRRC8B.
Información adicional
Size 100 uL
Gene Name LRRC8B
Gene Alias KIAA0231|MGC42220|TA-LRRP
Gene Description leucine rich repeat containing 8 family, member B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PSTSSRLEHFVAILHKCFDSPWTTRALSETVAEQSVRPLKLSKSKILLSSSGCSADIDSGKQSLPYPQPGLESAGIESPTSSVLDKKEGEQAKAIFEKVKRFRMHVEQKD
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LRRC8B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23507
Iso type IgG

Enviar uma mensagem


LRRC8B polyclonal antibody

LRRC8B polyclonal antibody