COL15A1 polyclonal antibody
  • COL15A1 polyclonal antibody

COL15A1 polyclonal antibody

Ref: AB-PAB20977
COL15A1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant COL15A1.
Información adicional
Size 100 uL
Gene Name COL15A1
Gene Alias FLJ38566
Gene Description collagen, type XV, alpha 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MPGEVEASGVAPGELDLSMSAQSLGEEATVGPSSEDSLTTAAAATEVSLSTFEDEEASGVPTDGLAPLTATMAPERAVTSGPGDEEDLAAA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human COL15A1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1306
Iso type IgG

Enviar uma mensagem


COL15A1 polyclonal antibody

COL15A1 polyclonal antibody