BEND3 polyclonal antibody
  • BEND3 polyclonal antibody

BEND3 polyclonal antibody

Ref: AB-PAB20974
BEND3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant BEND3.
Información adicional
Size 100 uL
Gene Name BEND3
Gene Alias KIAA1553|RP11-59I9.2
Gene Description BEN domain containing 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq CLPQLNDFFSRFWAQREMEDSQPSGQVASFFEAEQVDPGHFLDNKDQEEALSLDRSSTIASDHVVDTQDLTEFLDEASSPGEFAVFLLHRLFPELFDHRKLGEQYSCYGDGGKQELDPQRLQIIRNYTEIYFPD
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human BEND3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57673
Iso type IgG

Enviar uma mensagem


BEND3 polyclonal antibody

BEND3 polyclonal antibody