CIAO1 polyclonal antibody
  • CIAO1 polyclonal antibody

CIAO1 polyclonal antibody

Ref: AB-PAB20969
CIAO1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CIAO1.
Información adicional
Size 100 uL
Gene Name CIAO1
Gene Alias CIA1|WDR39
Gene Description cytosolic iron-sulfur protein assembly 1 homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq CSDDRTVRIWRQYLPGNEQGVACSGSDPSWKCICTLSGFHSRTIYDIAWCQLTGALATACGDDAIRVFQEDPNSDPQQPTFSLTAHLHQAHSQDVNCVAWNPKEPGLLASCSDDGEVAFWKYQR
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CIAO1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9391
Iso type IgG

Enviar uma mensagem


CIAO1 polyclonal antibody

CIAO1 polyclonal antibody