SLFN5 polyclonal antibody
  • SLFN5 polyclonal antibody

SLFN5 polyclonal antibody

Ref: AB-PAB20963
SLFN5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLFN5.
Información adicional
Size 100 uL
Gene Name SLFN5
Gene Alias MGC150611|MGC150612|MGC19764
Gene Description schlafen family member 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq ERHGVGLDVPPIFRSHLDKMQKENHFLIFVKSWNTEAGVPLATLCSNLYHRERTSTDVMDSQEALAFLKCRTQTPTNINVSNSLGPQAAQGSVQYEGNINVSAAALFDRKRLQYLEKLNLPESTHVEFVMFSTDVSHCVKD
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLFN5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 162394
Iso type IgG

Enviar uma mensagem


SLFN5 polyclonal antibody

SLFN5 polyclonal antibody