CNNM4 polyclonal antibody
  • CNNM4 polyclonal antibody

CNNM4 polyclonal antibody

Ref: AB-PAB20959
CNNM4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CNNM4.
Información adicional
Size 100 uL
Gene Name CNNM4
Gene Alias ACDP4|FLJ42791|KIAA1592
Gene Description cyclin M4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq FSYYGTMALTSVPSDRSPAHPTPLSRSASLSYPDRTDVSTAATLAGSSNQFGSSVLGQYISDFSVRALVDLQYIKITRQQYQNGLLASRMENSPQFPIDGCTTHMENLAEKSELPVVDETTTLLNERNSL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CNNM4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 26504
Iso type IgG

Enviar uma mensagem


CNNM4 polyclonal antibody

CNNM4 polyclonal antibody