FAM73A polyclonal antibody
  • FAM73A polyclonal antibody

FAM73A polyclonal antibody

Ref: AB-PAB20948
FAM73A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM73A.
Información adicional
Size 100 uL
Gene Name FAM73A
Gene Alias DKFZp686M07166|FLJ35093
Gene Description family with sequence similarity 73, member A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq QEEFEATLGASDPNSLADDIDKDTDITMKGNVEDFGLRDTLSIASTDSFASAAELAEHREVRHTYSLESLCHCPFYEEAMHLVEEGKIYSRVLRTEMLECLGDSDFLAKLHCIRQAFQVILSESANR
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM73A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 374986
Iso type IgG

Enviar uma mensagem


FAM73A polyclonal antibody

FAM73A polyclonal antibody