SGCZ polyclonal antibody
  • SGCZ polyclonal antibody

SGCZ polyclonal antibody

Ref: AB-PAB20947
SGCZ polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SGCZ.
Información adicional
Size 100 uL
Gene Name SGCZ
Gene Alias MGC149397|ZSG1
Gene Description sarcoglycan zeta
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PLYVKEIHSRKDSPLVLQSDRNVTVNARNHMGQLTGQLTIGADAVEAQCKRFEVRASEDGRVLFSADEDEITIGAEKLKVTGTEGAVFGHSVETPHIRAEPSQDL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SGCZ.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 137868
Iso type IgG

Enviar uma mensagem


SGCZ polyclonal antibody

SGCZ polyclonal antibody