MARC2 polyclonal antibody
  • MARC2 polyclonal antibody

MARC2 polyclonal antibody

Ref: AB-PAB20945
MARC2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MARC2.
Información adicional
Size 100 uL
Gene Name MARC2
Gene Alias MOSC2|RP11-270A6.1
Gene Description mitochondrial amidoxime reducing component 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RFWLVIKEDGHMVTARQEPRLVLISIIYENNCLIFRAPDMDQLVLPSKQPSSNKLHNCRIFGLDIKGRDCGNEAAKWFTNFLKTEAYRLVQFETNMKGRTSRKLLPTL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MARC2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54996
Iso type IgG

Enviar uma mensagem


MARC2 polyclonal antibody

MARC2 polyclonal antibody