LPP polyclonal antibody
  • LPP polyclonal antibody

LPP polyclonal antibody

Ref: AB-PAB20941
LPP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LPP.
Información adicional
Size 100 uL
Gene Name LPP
Gene Alias -
Gene Description LIM domain containing preferred translocation partner in lipoma
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P,IF
Immunogen Prot. Seq VVAPKPKYNPYKQPGGEGDFLPPPPPPLDDSSALPSISGNFPPPPPLDEEAFKVQGNPGGKTLEERRSSLDAEIDSLTSILADLECSSPYKPRPPQSSTGSTASPPVSTPVTGHKRMVIPNQPPLTATKKST
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LPP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4026
Iso type IgG

Enviar uma mensagem


LPP polyclonal antibody

LPP polyclonal antibody