GPM6A polyclonal antibody
  • GPM6A polyclonal antibody

GPM6A polyclonal antibody

Ref: AB-PAB20939
GPM6A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GPM6A.
Información adicional
Size 100 uL
Gene Name GPM6A
Gene Alias GPM6|M6A
Gene Description glycoprotein M6A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq YFNLWTICRNTTLVEGANLCLDLRQFGIVTIGEEKKICTVSENFLRMCESTELN
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GPM6A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 2823
Iso type IgG

Enviar uma mensagem


GPM6A polyclonal antibody

GPM6A polyclonal antibody