LRP12 polyclonal antibody
  • LRP12 polyclonal antibody

LRP12 polyclonal antibody

Ref: AB-PAB20931
LRP12 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LRP12.
Información adicional
Size 100 uL
Gene Name LRP12
Gene Alias DKFZp781F1053|FLJ12929|ST7
Gene Description low density lipoprotein-related protein 12
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq FPVCSPNQASVLENLRLAVRSQLGFTSVRLPMAGRSSNIWNRIFNFARSRHSGSLALVSADGDEVVPSQSTSREPERNHTHRSLFSVESDDTDTENERRDMAGASGGVAAPLPQKVPPTTAVEATVGACASSS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LRP12.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 29967
Iso type IgG

Enviar uma mensagem


LRP12 polyclonal antibody

LRP12 polyclonal antibody