ACPL2 polyclonal antibody
  • ACPL2 polyclonal antibody

ACPL2 polyclonal antibody

Ref: AB-PAB20930
ACPL2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ACPL2.
Información adicional
Size 100 uL
Gene Name ACPL2
Gene Alias FLJ23751
Gene Description acid phosphatase-like 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq STPKNGMSSKSRKRIMPDPVTEPPVTDPVYEALLYCNIPSVAERSMEGHAPHHFKLVSVHVFIRHGDRYPLYVIPKTKRPEIDCTLVANRKPYHPKLEAFISHMSKGSGASFESPLNSLPLYPNHP
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ACPL2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 92370
Iso type IgG

Enviar uma mensagem


ACPL2 polyclonal antibody

ACPL2 polyclonal antibody