MAN2A2 polyclonal antibody
  • MAN2A2 polyclonal antibody

MAN2A2 polyclonal antibody

Ref: AB-PAB20929
MAN2A2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MAN2A2.
Información adicional
Size 100 uL
Gene Name MAN2A2
Gene Alias MANA2X
Gene Description mannosidase, alpha, class 2A, member 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq HHDAITGTAKEAVVVDYGVRLLRSLVNLKQVIIHAAHYLVLGDKETYHFDPEAPFLQVDDTRLSHDALPERTVIQLDSSPRFVVLFNPLEQERFSMVSLLVNSPRVRVLSEEGQPLAVQISAHWSSATEAVPDVYQVSVP
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MAN2A2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4122
Iso type IgG

Enviar uma mensagem


MAN2A2 polyclonal antibody

MAN2A2 polyclonal antibody