PLBD2 polyclonal antibody
  • PLBD2 polyclonal antibody

PLBD2 polyclonal antibody

Ref: AB-PAB20924
PLBD2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PLBD2.
Información adicional
Size 100 uL
Gene Name PLBD2
Gene Alias -
Gene Description mannose-6-phosphate protein p76
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GDWFSYDGSPRAQIFRRNQSLVQDMDSMVRLMRYNDFLHDPLSLCKACNPQPNGENAISARSDLNPANGSYPFQALRQRSHGGIDVKVTSMSLARILSLLAASGPTWDQVPPFQWSTS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PLBD2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 196463
Iso type IgG

Enviar uma mensagem


PLBD2 polyclonal antibody

PLBD2 polyclonal antibody