SDC3 polyclonal antibody
  • SDC3 polyclonal antibody

SDC3 polyclonal antibody

Ref: AB-PAB20923
SDC3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SDC3.
Información adicional
Size 100 uL
Gene Name SDC3
Gene Alias N-syndecan|SDCN|SYND3
Gene Description syndecan 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TPRLVSTATSRPRALPRPATTQEPDIPERSTLPLGTTAPGPTEVAQTPTPETFLTTIRDEPEVPVSGGPSGDFELPEEETTQPDTANEVVAVGGAAAKASSPPGTLPKGARPGPGLLDNAIDSGSSAAQLPQKSILERK
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SDC3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9672
Iso type IgG

Enviar uma mensagem


SDC3 polyclonal antibody

SDC3 polyclonal antibody