PTGFRN polyclonal antibody
  • PTGFRN polyclonal antibody

PTGFRN polyclonal antibody

Ref: AB-PAB20920
PTGFRN polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PTGFRN.
Información adicional
Size 100 uL
Gene Name PTGFRN
Gene Alias CD315|CD9P-1|EWI-F|FLJ11001|FPRP|KIAA1436|SMAP-6
Gene Description prostaglandin F2 receptor negative regulator
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NSGYYYCHVSLWAPGHNRSWHKVAEAVSSPAGVGVTWLEPDYQVYLNASKVPGFADDPTELACRVVDTKSGEANVRFTVSWYYRMNRRSDNVVTSELLAVMDGDW
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PTGFRN.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5738
Iso type IgG

Enviar uma mensagem


PTGFRN polyclonal antibody

PTGFRN polyclonal antibody