VEZT polyclonal antibody
  • VEZT polyclonal antibody

VEZT polyclonal antibody

Ref: AB-PAB20919
VEZT polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant VEZT.
Información adicional
Size 100 uL
Gene Name VEZT
Gene Alias DKFZp761C241|VEZATIN
Gene Description vezatin, adherens junctions transmembrane protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq PFLDNVTNYICVVPFKELGLGLSEEQISEEEAHNFTDGFSLPALKVLFQLWVAQSSEFFRRLALLLSTANSPPGPLLTPALLPHRILSDVTQGLPHAHSACLEELKRSYEFYRYFETQHQSVPQCLSKTQQKSRELNNV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human VEZT.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55591
Iso type IgG

Enviar uma mensagem


VEZT polyclonal antibody

VEZT polyclonal antibody