UTS2 polyclonal antibody
  • UTS2 polyclonal antibody

UTS2 polyclonal antibody

Ref: AB-PAB20916
UTS2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant UTS2.
Información adicional
Size 100 uL
Gene Name UTS2
Gene Alias PRO1068|U-II|UCN2|UII
Gene Description urotensin 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TNVFHLMLCVTSARTHKSTSLCFGHFNSYPSLPLIHDLLLEISFQLSAPHEDARLTPEELERASLLQILPEMLGAERGDILRKADSSTNIFNPRGNLRKFQDFSGQDPNILLSHLLARIWKPYKKRETPDCFWKYCV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human UTS2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10911
Iso type IgG

Enviar uma mensagem


UTS2 polyclonal antibody

UTS2 polyclonal antibody