ZNF831 polyclonal antibody
  • ZNF831 polyclonal antibody

ZNF831 polyclonal antibody

Ref: AB-PAB20908
ZNF831 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF831.
Información adicional
Size 100 uL
Gene Name ZNF831
Gene Alias C20orf174|dJ492J12.1
Gene Description zinc finger protein 831
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ESPPCCGKEEKKEGDCRQTLGTLSLGTSSRIVREMDKRTVKDISPSAGEHGDCTTHSTAATSGLSLQSDTCLAVVNDVPLPPGKGLDLGLLETQLLASQDSVSTDPKPYIFSDAQRPSSFGSKGTFPHHD
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF831.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 128611
Iso type IgG

Enviar uma mensagem


ZNF831 polyclonal antibody

ZNF831 polyclonal antibody