SLC15A4 polyclonal antibody
  • SLC15A4 polyclonal antibody

SLC15A4 polyclonal antibody

Ref: AB-PAB20900
SLC15A4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC15A4.
Información adicional
Size 100 uL
Gene Name SLC15A4
Gene Alias FP12591|PHT1|PTR4
Gene Description solute carrier family 15, member 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TKPPDGSAFTDMFKILTYSCCSQKRSGERQSNGEGIGVFQQSSKQSLFDSCKMSHGGPFTEEKVEDVK
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC15A4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 121260
Iso type IgG

Enviar uma mensagem


SLC15A4 polyclonal antibody

SLC15A4 polyclonal antibody