TREML1 polyclonal antibody
  • TREML1 polyclonal antibody

TREML1 polyclonal antibody

Ref: AB-PAB20899
TREML1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TREML1.
Información adicional
Size 100 uL
Gene Name TREML1
Gene Alias GLTL1825|MGC119173|PRO3438|TLT-1|TLT1|dJ238O23.3
Gene Description triggering receptor expressed on myeloid cells-like 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq KRKQGNRLGVCGRFLSSRVSGMNPSSVVHHVSDSGPAAELPLDVPHIRLDSPPSFDNTTYTSLPLDSPSGKPSLPAPSSLPPLPPKVLVCSKPVTYATVIFPGGNKGGGTSCGPAQNPPNNQTPSS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TREML1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 340205
Iso type IgG

Enviar uma mensagem


TREML1 polyclonal antibody

TREML1 polyclonal antibody