GP2 polyclonal antibody
  • GP2 polyclonal antibody

GP2 polyclonal antibody

Ref: AB-PAB20897
GP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GP2.
Información adicional
Size 100 uL
Gene Name GP2
Gene Alias DKFZp779K0533|ZAP75
Gene Description glycoprotein 2 (zymogen granule membrane)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NPIEASSYGLDLDCGAPGTPEAHVCFDPCQNYTLLDEPFRSTENSAGSQGCDKNMSGWYRFVGEGGVRMSETCVQVHRCQTDAPMWLNGTHPALGDGITNHTACAHWSGNCCFWKTEVLVKACPGGYHVYRLEGTPWCNLRYCT
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 2813
Iso type IgG

Enviar uma mensagem


GP2 polyclonal antibody

GP2 polyclonal antibody