CNTN6 polyclonal antibody
  • CNTN6 polyclonal antibody

CNTN6 polyclonal antibody

Ref: AB-PAB20895
CNTN6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CNTN6.
Información adicional
Size 100 uL
Gene Name CNTN6
Gene Alias MGC133256|NB3
Gene Description contactin 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TQEPHDVIFPLDLSKSEVILNCAANGYPSPHYRWKQNGTDIDFTMSYHYRLDGGSLAINSPHTDQDIGMYQCLATNLLGTILSRKAKLQF
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CNTN6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 27255
Iso type IgG

Enviar uma mensagem


CNTN6 polyclonal antibody

CNTN6 polyclonal antibody