PERLD1 polyclonal antibody
  • PERLD1 polyclonal antibody

PERLD1 polyclonal antibody

Ref: AB-PAB20888
PERLD1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PERLD1.
Información adicional
Size 100 uL
Gene Name PERLD1
Gene Alias AGLA546|CAB2|MGC9753|PGAP3|PP1498
Gene Description per1-like domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SQGDREPVYRDCVLQCEEQNCSGGALNHFRSRQPIYMSLAGWTCRDDCKYECMWVTVGLYLQEGHKVPQFHGKWP
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PERLD1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 93210
Iso type IgG

Enviar uma mensagem


PERLD1 polyclonal antibody

PERLD1 polyclonal antibody