SLC35E1 polyclonal antibody
  • SLC35E1 polyclonal antibody

SLC35E1 polyclonal antibody

Ref: AB-PAB20885
SLC35E1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC35E1.
Información adicional
Size 100 uL
Gene Name SLC35E1
Gene Alias DKFZp564G0462|FLJ14251|FLJ36689|MGC44954
Gene Description solute carrier family 35, member E1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq NKTKYDANQQARKHLLPVTTADLSSKERHRSPLEKPHNGLLFPQHGDYQYGRNNILTDHFQYSRQSYPNSYSLNRYDV
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC35E1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79939
Iso type IgG

Enviar uma mensagem


SLC35E1 polyclonal antibody

SLC35E1 polyclonal antibody