TMTC4 polyclonal antibody
  • TMTC4 polyclonal antibody

TMTC4 polyclonal antibody

Ref: AB-PAB20875
TMTC4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMTC4.
Información adicional
Size 100 uL
Gene Name TMTC4
Gene Alias FLJ14624|FLJ22153
Gene Description transmembrane and tetratricopeptide repeat containing 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NLGRLYADLNRHVDALNAWRNATVLKPEHSLAWNNMIILLDNTGNLAQAEAVGREALELIPNDHSLMFSLANVLGKSQKYKESEALFLKAIKANPNAASYHGNLAVLYHRWGHLDLAKKHYEISLQLDPTASGTKENYGLLR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMTC4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84899
Iso type IgG

Enviar uma mensagem


TMTC4 polyclonal antibody

TMTC4 polyclonal antibody