ZNF185 polyclonal antibody
  • ZNF185 polyclonal antibody

ZNF185 polyclonal antibody

Ref: AB-PAB20870
ZNF185 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF185.
Información adicional
Size 100 uL
Gene Name ZNF185
Gene Alias -
Gene Description zinc finger protein 185 (LIM domain)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq HSYVLSAAKKSTGSPTQETQAPFIAKRVEVVEEDGPSEKSQDPPALARSTPGSNSSRGEEIVRLQILTPRAGLRLVAPDVEGMRSSPGNKDKEAPCSRELQRDLAGEEAFRAPNTDAARSSAQLSDGNVGSGATGSRPEGLAAVDIGSERGSSSATSVSAAPADRKSNSTAAQEDAKAD
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF185.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7739
Iso type IgG

Enviar uma mensagem


ZNF185 polyclonal antibody

ZNF185 polyclonal antibody