WDR53 polyclonal antibody
  • WDR53 polyclonal antibody

WDR53 polyclonal antibody

Ref: AB-PAB20868
WDR53 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant WDR53.
Información adicional
Size 100 uL
Gene Name WDR53
Gene Alias MGC64882
Gene Description WD repeat domain 53
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P
Immunogen Prot. Seq PVLCLNASKEGLLASGAEGGDLTAWGEDGTPLGHTRFQGADDVTSVLFSPSCPTKLYASHGETISVLDVRSLKDSLDHFHVNEEEINCLSLNQTENLLASADDSGAIKILDLENKKVIRSLKRHSNICSSV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human WDR53.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 348793
Iso type IgG

Enviar uma mensagem


WDR53 polyclonal antibody

WDR53 polyclonal antibody