KCNK1 polyclonal antibody
  • KCNK1 polyclonal antibody

KCNK1 polyclonal antibody

Ref: AB-PAB20865
KCNK1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KCNK1.
Información adicional
Size 100 uL
Gene Name KCNK1
Gene Alias DPK|HOHO|K2p1.1|KCNO1|TWIK-1|TWIK1
Gene Description potassium channel, subfamily K, member 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq YVKKDKDEDQVHIIEHDQLSFSSITDQAAGMKEDQKQNEPFVATQSSACVDGPAN
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KCNK1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 3775
Iso type IgG

Enviar uma mensagem


KCNK1 polyclonal antibody

KCNK1 polyclonal antibody