TSPAN3 polyclonal antibody
  • TSPAN3 polyclonal antibody

TSPAN3 polyclonal antibody

Ref: AB-PAB20863
TSPAN3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TSPAN3.
Información adicional
Size 100 uL
Gene Name TSPAN3
Gene Alias TM4-A|TM4SF8|TSPAN-3
Gene Description tetraspanin 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NGTNPDAASRAIDYVQRQLHCCGIHNYSDWENTDWFKETKNQSVPLSCCRETASNCNGSLAHPSDLYAEGCEALVVKKLQEI
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TSPAN3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10099
Iso type IgG

Enviar uma mensagem


TSPAN3 polyclonal antibody

TSPAN3 polyclonal antibody