MYLK4 polyclonal antibody
  • MYLK4 polyclonal antibody

MYLK4 polyclonal antibody

Ref: AB-PAB20852
MYLK4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MYLK4.
Información adicional
Size 100 uL
Gene Name MYLK4
Gene Alias SgK085
Gene Description myosin light chain kinase family, member 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SGLSPFLGDNDAETLNNILACRWDLEDEEFQDISEEAKEFISKLLIKEKSWRISASEALKHPWLSDHKLHSRLNAQKKKNRGSDAQDFV
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MYLK4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 340156
Iso type IgG

Enviar uma mensagem


MYLK4 polyclonal antibody

MYLK4 polyclonal antibody