RNF38 polyclonal antibody
  • RNF38 polyclonal antibody

RNF38 polyclonal antibody

Ref: AB-PAB20851
RNF38 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RNF38.
Información adicional
Size 100 uL
Gene Name RNF38
Gene Alias FLJ21343
Gene Description ring finger protein 38
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VVFSGQHLPVCSVPPPMLQACSVQHLPVPYAAFPPLISSDPFLIHPPHLSPHHPPHLPPPGQFVPFQTQQSRSPLQRIENEVELLGEHLPVGGFTYPPSAHPPTLPPSAPL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RNF38.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 152006
Iso type IgG

Enviar uma mensagem


RNF38 polyclonal antibody

RNF38 polyclonal antibody